PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000257674
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 395aa    MW: 44743.5 Da    PI: 7.3635
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000257674genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.6e-5391381129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeel+++yLkkkv+ +k+++ evi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + 
  MDP0000257674   9 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-EVIREVDLNKMEPWDLQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIR 103
                    69****************************.99**************963433332556************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  MDP0000257674 104 N-TFKQIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 138
                    9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-597161IPR003441NAC domain
PROSITE profilePS5100557.8029161IPR003441NAC domain
PfamPF023657.4E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MANSSSGGVP PGFRFHPTDE ELLHYYLKKK VSFQKFDMEV IREVDLNKME PWDLQERCRI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATNA GFWKATGRDK CIRNTFKQIG MRKTLVFYRG  120
RAPHGQKTDW IMHEYRLEDG DDPDGNLSSE DGWVICRVFK KKNLFKVANE GGSSSMNSSD  180
HQQLKNTSSN SQLQARSFMH SHRDNQYLLR QQHHAAAQAF ELNNNPSLHY AHLQPPPPYS  240
LFQSQALIPT LAHKPLSAYD DYSSQHPSDD SPSHGMVKQL MTNPRDRESG SEGLRYQACE  300
PVLEVGTCEP NHQLNTVAGG AGAAGGRDNN HDHQGMSEWA MLDRLVTSHD LGNDQDSSSK  360
GAARYEDANA PSSVNQINPQ HLSLRGEMDF WGYAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51916317167NO APICAL MERISTEM PROTEIN
1ut4_B2e-51916317167NO APICAL MERISTEM PROTEIN
1ut7_A2e-51916317167NO APICAL MERISTEM PROTEIN
1ut7_B2e-51916317167NO APICAL MERISTEM PROTEIN
4dul_A2e-51916317167NAC domain-containing protein 19
4dul_B2e-51916317167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008346421.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9SV871e-154BRN2_ARATH; Protein BEARSKIN2
TrEMBLM5VLK30.0M5VLK3_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s09400.11e-173(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-149NAC domain containing protein 70